TPRKB (NM_016058) Human Mass Spec Standard
CAT#: PH306008
TPRKB MS Standard C13 and N15-labeled recombinant protein (NP_057142)
View other "TPRKB" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | TPRKB MS Standard C13 and N15-labeled recombinant protein (NP_057142) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC206008 | 
| Predicted MW | 19.7 kDa | 
| Protein Sequence | 
                 >RC206008 protein sequence 
Red=Cloning site Green=Tags(s) MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKM KTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIM NITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_057142 | 
| RefSeq Size | 752 | 
| RefSeq ORF | 525 | 
| Synonyms | CGI-121; CGI121; GAMOS5 | 
| Locus ID | 51002 | 
| Cytogenetics | 2p13.1 | 
| Summary | Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:28805828). The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37 (PubMed:22912744, PubMed:28805828). TPRKB acts as an allosteric effector that regulates the t(6)A activity of the complex. TPRKB is not required for tRNA modification (PubMed:22912744, PubMed:28805828).[UniProtKB/Swiss-Prot Function] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC414223 | TPRKB HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY414223 | Transient overexpression lysate of TP53RK binding protein (TPRKB) | 
                                                     CNY 3080.00  | 
                                            |
| TP306008 | Recombinant protein of human TP53RK binding protein (TPRKB), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
