COX5A (NM_004255) Human Mass Spec Standard
CAT#: PH306046
COX5A MS Standard C13 and N15-labeled recombinant protein (NP_004246)
View other "COX5A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | COX5A MS Standard C13 and N15-labeled recombinant protein (NP_004246) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206046 |
Predicted MW | 16.8 kDa |
Protein Sequence |
>RC206046 protein sequence
Red=Cloning site Green=Tags(s) MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWEL RKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGIS TPEELGLDKV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004246 |
RefSeq Size | 784 |
RefSeq ORF | 450 |
Synonyms | COX; COX-VA; MC4DN20; VA |
Locus ID | 9377 |
Cytogenetics | 15q24.2 |
Summary | Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer of proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Va of the human mitochondrial respiratory chain enzyme. A pseudogene COX5AP1 has been found in chromosome 14q22. [provided by RefSeq, Jul 2008] |
Protein Pathways | Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418109 | COX5A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418109 | Transient overexpression lysate of cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
TP306046 | Recombinant protein of human cytochrome c oxidase subunit Va (COX5A), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |