BMPR1A (NM_004329) Human Mass Spec Standard
CAT#: PH306048
BMPR1A MS Standard C13 and N15-labeled recombinant protein (NP_004320)
View other "BMPR1A" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | BMPR1A MS Standard C13 and N15-labeled recombinant protein (NP_004320) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206048 |
Predicted MW | 60.2 kDa |
Protein Sequence |
>RC206048 protein sequence
Red=Cloning site Green=Tags(s) MPQLYIYIRLLGAYLFIISRVQGQNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDD AINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP VVIGPFFDGSIRWLVLLISMAVCIIAMIIFSSCFCYKHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLI DQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQT VLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIY GTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKN HFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSD ECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004320 |
RefSeq Size | 3631 |
RefSeq ORF | 1596 |
Synonyms | 10q23del; ACVRLK3; ALK3; CD292; SKR5 |
Locus ID | 657 |
Cytogenetics | 10q23.2 |
Summary | The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A and BMPR1B and the type II receptor BMPR2. These receptors are also closely related to the activin receptors, ACVR1 and ACVR2. The ligands of these receptors are members of the TGF-beta superfamily. TGF-betas and activins transduce their signals through the formation of heteromeric complexes with 2 different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, TGF-beta signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418061 | BMPR1A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418061 | Transient overexpression lysate of bone morphogenetic protein receptor, type IA (BMPR1A) |
CNY 3080.00 |
|
TP306048 | Recombinant protein of human bone morphogenetic protein receptor, type IA (BMPR1A), 20 µg |
CNY 2900.00 |