PMP2 (NM_002677) Human Mass Spec Standard
CAT#: PH306053
PMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002668)
View other "PMP2" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PMP2 MS Standard C13 and N15-labeled recombinant protein (NP_002668) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206053 |
| Predicted MW | 14.9 kDa |
| Protein Sequence |
>RC206053 protein sequence
Red=Cloning site Green=Tags(s) MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQE FEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002668 |
| RefSeq Size | 3579 |
| RefSeq ORF | 396 |
| Synonyms | CMT1G; FABP8; M-FABP; MP2; P2 |
| Locus ID | 5375 |
| Cytogenetics | 8q21.13 |
| Summary | The protein encoded by this gene localizes to myelin sheaths of the peripheral nervous system. The encoded protein can bind both the membrane layers of the sheaths and monomeric lipids, and is thought to provide stability to the sheath. A defect in this gene was shown to be a cause of dominant demyelinating CMT neuropathy. [provided by RefSeq, Jan 2017] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400948 | PMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400948 | Transient overexpression lysate of peripheral myelin protein 2 (PMP2) |
CNY 3080.00 |
|
| TP306053 | Recombinant protein of human peripheral myelin protein 2 (PMP2), 20 µg |
CNY 2900.00 |
|
| TP720618 | Purified recombinant protein of Human peripheral myelin protein 2 (PMP2) |
CNY 1800.00 |
