NME5 (NM_003551) Human Mass Spec Standard
CAT#: PH306058
NME5 MS Standard C13 and N15-labeled recombinant protein (NP_003542)
View other "NME5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NME5 MS Standard C13 and N15-labeled recombinant protein (NP_003542) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206058 |
| Predicted MW | 24.2 kDa |
| Protein Sequence |
>RC206058 protein sequence
Red=Cloning site Green=Tags(s) MEISMPPPQIYVEKTLAIIKPDIVDKEEEIQDIILRSGFTIVQRRKLRLSPEQCSNFYVEKYGKMFFPNL TAYMSSGPLVAMILARHKAISYWLELLGPNNSLVAKETHPDSLRAIYGTDDLRNALHGSNDFAAAEREIR FMFPEVIVEPIPIGQAAKDYLNLHIMPTLLEGLTELCKQKPADPLIWLADWLLKNNPNKPKLCHHPIVEE PY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_003542 |
| RefSeq Size | 1243 |
| RefSeq ORF | 636 |
| Synonyms | NM23-H5; NM23H5; RSPH23 |
| Locus ID | 8382 |
| Cytogenetics | 5q31.2 |
| Summary | Does not seem to have NDK kinase activity. Confers protection from cell death by Bax and alters the cellular levels of several antioxidant enzymes including Gpx5. May play a role in spermiogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418593 | NME5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY418593 | Transient overexpression lysate of non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (NME5) |
CNY 3080.00 |
|
| TP306058 | Recombinant protein of human non-metastatic cells 5, protein expressed in (nucleoside-diphosphate kinase) (NME5), 20 µg |
CNY 2900.00 |
