RYBP (NM_012234) Human Mass Spec Standard
CAT#: PH306186
RYBP MS Standard C13 and N15-labeled recombinant protein (NP_036366)
View other "RYBP" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | RYBP MS Standard C13 and N15-labeled recombinant protein (NP_036366) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206186 |
Predicted MW | 24.9 kDa |
Protein Sequence |
>RC206186 protein sequence
Red=Cloning site Green=Tags(s) MTMGDKKSPTRPKRQAKPATDEGFWDCSVCTFRNSAEAFKCSICDVRKGTSTRKPRINSQLVAQQVAQQY ATPPPPKKEKKEKVEKQDKEKPEKDKEISPSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSET NHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGS SRSSTPKGDMSAVNDESF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036366 |
RefSeq Size | 4678 |
RefSeq ORF | 684 |
Synonyms | AAP1; APAP-1; DEDAF; YEAF1 |
Locus ID | 23429 |
Cytogenetics | 3p13 |
Summary | Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1-like complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:25519132). Component of a PRC1-like complex that mediates monoubiquitination of histone H2A 'Lys-119' on the X chromosome and is required for normal silencing of one copy of the X chromosome in XX females. May stimulate ubiquitination of histone H2A 'Lys-119' by recruiting the complex to target sites (By similarity). Inhibits ubiquitination and subsequent degradation of TP53, and thereby plays a role in regulating transcription of TP53 target genes (PubMed:19098711). May also regulate the ubiquitin-mediated proteasomal degradation of other proteins like FANK1 to regulate apoptosis (PubMed:14765135, PubMed:27060496). May be implicated in the regulation of the transcription as a repressor of the transcriptional activity of E4TF1 (PubMed:11953439). May bind to DNA (By similarity). May play a role in the repression of tumor growth and metastasis in breast cancer by down-regulating SRRM3 (PubMed:27748911).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415887 | RYBP HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415887 | Transient overexpression lysate of RING1 and YY1 binding protein (RYBP) |
CNY 3080.00 |
|
TP306186 | Recombinant protein of human RING1 and YY1 binding protein (RYBP), 20 µg |
CNY 2900.00 |