ECRG4 (NM_032411) Human Mass Spec Standard
CAT#: PH306239
C2orf40 MS Standard C13 and N15-labeled recombinant protein (NP_115787)
View other "ECRG4" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | C2orf40 MS Standard C13 and N15-labeled recombinant protein (NP_115787) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206239 |
| Predicted MW | 17.2 kDa |
| Protein Sequence |
>RC206239 protein sequence
Red=Cloning site Green=Tags(s) MAASPARPAVLALTGLALLLLLCWGPGGISGNKLKLMLQKREAPVPTKTKVAVDENKAKEFLGSLKRQKR QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPRSPYGFRHG ASVNYDDY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_115787 |
| RefSeq Size | 793 |
| RefSeq ORF | 444 |
| Synonyms | C2orf40 |
| Locus ID | 84417 |
| Cytogenetics | 2q12.2 |
| Summary | Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system (By similarity). ECRG4-induced senescence is characterized by G1 arrest, RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation (By similarity).[UniProtKB/Swiss-Prot Function] |
| Protein Families | Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403168 | C2orf40 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY403168 | Transient overexpression lysate of chromosome 2 open reading frame 40 (C2orf40) |
CNY 3080.00 |
|
| TP306239 | Recombinant protein of human chromosome 2 open reading frame 40 (C2orf40), 20 µg |
CNY 2900.00 |
