FBXL2 (NM_012157) Human Mass Spec Standard
CAT#: PH306390
FBXL2 MS Standard C13 and N15-labeled recombinant protein (NP_036289)
View other "FBXL2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | FBXL2 MS Standard C13 and N15-labeled recombinant protein (NP_036289) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206390 |
Predicted MW | 47.1 kDa |
Protein Sequence |
>RC206390 protein sequence
Red=Cloning site Green=Tags(s) MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVE NISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC VSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHEL VSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTL LARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDN CLLITDVALEHLENCRGLERLELYDCQQVTRAGIKRMRAQLPHVKVHAYFAPVTPPTAVAGSGQRLCRCC VIL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036289 |
RefSeq Size | 3000 |
RefSeq ORF | 1269 |
Synonyms | FBL2; FBL3 |
Locus ID | 25827 |
Cytogenetics | 3p22.3 |
Summary | This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbls class and, in addition to an F-box, contains 12 tandem leucine-rich repeats. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415925 | FBXL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432929 | FBXL2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415925 | Transient overexpression lysate of F-box and leucine-rich repeat protein 2 (FBXL2), transcript variant 1 |
CNY 3080.00 |
|
LY432929 | Transient overexpression lysate of F-box and leucine-rich repeat protein 2 (FBXL2), transcript variant 2 |
CNY 3080.00 |
|
TP306390 | Purified recombinant protein of Homo sapiens F-box and leucine-rich repeat protein 2 (FBXL2), 20 µg |
CNY 2900.00 |