KRTAP3-2 (NM_031959) Human Mass Spec Standard
CAT#: PH306391
KRTAP3 MS Standard C13 and N15-labeled recombinant protein (NP_114165)
View other "KRTAP3-2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | KRTAP3 MS Standard C13 and N15-labeled recombinant protein (NP_114165) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206391 |
| Predicted MW | 10.4 kDa |
| Protein Sequence |
>RC206391 protein sequence
Red=Cloning site Green=Tags(s) MDCCASRSCSVPTGPATTICSSDKSCRCGVCLPSTCPHTVWLLEPICCDNCPPPCHIPQPCVPTCFLLNS CQPTPGLETLNLTTFTQPCCEPCLPRGC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_114165 |
| RefSeq Size | 749 |
| RefSeq ORF | 294 |
| Synonyms | KAP3.2; KRTAP3.2 |
| Locus ID | 83897 |
| Cytogenetics | 17q21.2 |
| Summary | This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410411 | KRTAP3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410411 | Transient overexpression lysate of keratin associated protein 3-2 (KRTAP3-2) |
CNY 3080.00 |
|
| TP306391 | Recombinant protein of human keratin associated protein 3-2 (KRTAP3-2), 20 µg |
CNY 2900.00 |
其它KRTAP3-2产品
