FGFBP2 (NM_031950) Human Mass Spec Standard
CAT#: PH306392
FGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114156)
View other "FGFBP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | FGFBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114156) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206392 |
Predicted MW | 24.6 kDa |
Protein Sequence |
>RC206392 protein sequence
Red=Cloning site Green=Tags(s) MKFVPCLLLVTLSCLGTLGQAPRQKQGSTGEEFHFQTGGRDSCTMRPSSLGQGAGEVWLRVDCRNTDQTY WCEYRGQPSMCQAFAADPKPYWNQALQELRRLHHACQGAPVLRPSVCREAGPQAHMQQVTSSLKGSPEPN QQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTRPTAKPTQPGPRPGGNEEAKKKAWEHCWKPF QALCAFLISFFRG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_114156 |
RefSeq Size | 1188 |
RefSeq ORF | 669 |
Synonyms | HBP17RP; KSP37 |
Locus ID | 83888 |
Cytogenetics | 4p15.32 |
Summary | This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.[provided by RefSeq Staff, Oct 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410396 | FGFBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY410396 | Transient overexpression lysate of fibroblast growth factor binding protein 2 (FGFBP2) |
CNY 3080.00 |
|
TP306392 | Recombinant protein of human fibroblast growth factor binding protein 2 (FGFBP2), 20 µg |
CNY 2900.00 |