IL3RA (NM_002183) Human Mass Spec Standard
CAT#: PH306420
IL3RA MS Standard C13 and N15-labeled recombinant protein (NP_002174)
View other "IL3RA" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 3600.00
Specifications
Product Data | |
Description | IL3RA MS Standard C13 and N15-labeled recombinant protein (NP_002174) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206420 |
Predicted MW | 43.33 kDa |
Protein Sequence |
>RC206420 representing NM_002183
Red=Cloning site Green=Tags(s) MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQF GAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYL NVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTP PNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYE FLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQ NDKLVVWEAGKAGLEECLVTEVQVVQKT myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002174 |
RefSeq Size | 1726 |
RefSeq ORF | 1134 |
Synonyms | CD123; hIL-3Ra; IL3R; IL3RAY; IL3RX; IL3RY |
Locus ID | 3563 |
Cytogenetics | X;Y |
Summary | The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jun 2012] |
Protein Families | Transmembrane |
Protein Pathways | Apoptosis, Cytokine-cytokine receptor interaction, Hematopoietic cell lineage, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419481 | IL3RA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419481 | Transient overexpression lysate of interleukin 3 receptor, alpha (low affinity) (IL3RA) |
CNY 3080.00 |
|
TP306420 | Recombinant protein of human interleukin 3 receptor, alpha (low affinity) (IL3RA), 20 µg |
CNY 2900.00 |
|
TP723926 | Human CD123 Protein, hFc-His Tag |
CNY 5552.00 |
|
TP762389 | Purified recombinant protein of Human interleukin 3 receptor, alpha (low affinity) (IL3RA), Thr19-Arg305, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1950.00 |