FOXI1 (NM_144769) Human Mass Spec Standard
CAT#: PH306430
FOXI1 MS Standard C13 and N15-labeled recombinant protein (NP_658982)
View other "FOXI1" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | FOXI1 MS Standard C13 and N15-labeled recombinant protein (NP_658982) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206430 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC206430 protein sequence
Red=Cloning site Green=Tags(s) MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTM TPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAP DKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPAYVSGGSPTSHPLVTPGLS PEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHFYNSVNTSGVLYPREG TEV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_658982 |
RefSeq Size | 2011 |
RefSeq ORF | 849 |
Synonyms | FKH10; FKHL10; FREAC-6; FREAC6; HFH-3; HFH3 |
Locus ID | 2299 |
Cytogenetics | 5q35.1 |
Summary | This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4. [provided by RefSeq, Jan 2017] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402162 | FOXI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408109 | FOXI1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402162 | Transient overexpression lysate of forkhead box I1 (FOXI1), transcript variant 1 |
CNY 3080.00 |
|
LY408109 | Transient overexpression lysate of forkhead box I1 (FOXI1), transcript variant 2 |
CNY 3080.00 |
|
TP306430 | Recombinant protein of human forkhead box I1 (FOXI1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP760413 | Purified recombinant protein of Human forkhead box I1 (FOXI1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |