GRAP2 (NM_004810) Human Mass Spec Standard
CAT#: PH306546
GRAP2 MS Standard C13 and N15-labeled recombinant protein (NP_004801)
View other "GRAP2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | GRAP2 MS Standard C13 and N15-labeled recombinant protein (NP_004801) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206546 |
Predicted MW | 37.9 kDa |
Protein Sequence |
>RC206546 protein sequence
Red=Cloning site Green=Tags(s) MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAEN LLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQ KQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPA PQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALY DFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004801 |
RefSeq Size | 3514 |
RefSeq ORF | 990 |
Synonyms | GADS; GRAP-2; GRB2L; GRBLG; GrbX; Grf40; GRID; GRPL; Mona; P38 |
Locus ID | 9402 |
Cytogenetics | 22q13.1 |
Summary | This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Apr 2014] |
Protein Families | Druggable Genome |
Protein Pathways | T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401511 | GRAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401511 | Transient overexpression lysate of GRB2-related adaptor protein 2 (GRAP2) |
CNY 3080.00 |
|
TP306546 | Recombinant protein of human GRB2-related adaptor protein 2 (GRAP2), 20 µg |
CNY 2900.00 |