Nkx2.5 (NKX2-5) (NM_004387) Human Mass Spec Standard
CAT#: PH306550
NKX2 MS Standard C13 and N15-labeled recombinant protein (NP_004378)
View other "Nkx2.5" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NKX2 MS Standard C13 and N15-labeled recombinant protein (NP_004378) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206550 |
| Predicted MW | 34.9 kDa |
| Protein Sequence |
>RC206550 protein sequence
Red=Cloning site Green=Tags(s) MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELR AELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRK PRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPP PPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSP AQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004378 |
| RefSeq Size | 1669 |
| RefSeq ORF | 972 |
| Synonyms | CHNG5; CSX; CSX1; HLHS2; NKX2.5; NKX2E; NKX4-1; VSD3 |
| Locus ID | 1482 |
| Cytogenetics | 5q35.1 |
| Summary | This gene encodes a homeobox-containing transcription factor. This transcription factor functions in heart formation and development. Mutations in this gene cause atrial septal defect with atrioventricular conduction defect, and also tetralogy of Fallot, which are both heart malformation diseases. Mutations in this gene can also cause congenital hypothyroidism non-goitrous type 5, a non-autoimmune condition. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401397 | NKX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401397 | Transient overexpression lysate of NK2 transcription factor related, locus 5 (Drosophila) (NKX2-5), transcript variant 1 |
CNY 3080.00 |
|
| TP306550 | Recombinant protein of human NK2 transcription factor related, locus 5 (Drosophila) (NKX2-5), 20 µg |
CNY 2900.00 |

