RBMS2 (NM_002898) Human Mass Spec Standard
CAT#: PH306581
RBMS2 MS Standard C13 and N15-labeled recombinant protein (NP_002889)
View other "RBMS2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | RBMS2 MS Standard C13 and N15-labeled recombinant protein (NP_002889) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206581 |
Predicted MW | 44 kDa |
Protein Sequence |
>RC206581 protein sequence
Red=Cloning site Green=Tags(s) MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGNDQLSKTNLYIRGLQPGTTDQ DLVKLCQPYGKIVSTKAILDKTTNKCKGYGFVDFDSPSAAQKAVTALKASGVQAQMAKQQEQDPTNLYIS NLPLSMDEQELEGMLKPFGQVISTRILRDTSGTSRGVGFARMESTEKCEAIITHFNGKYIKTPPGVPAPS DPLLCKFADGGPKKRQNQGKFVQNGRAWPRNADMGVMALTYDPTTALQNGFYPAPYNITPNRMLAQSALS PYLSSPVSSYQRVTQTSPLQVPNPSWMHHHSYLMQPSGSVLTPGMDHPISLQPASMMGPLTQQLGHLSLS STGTYMPTAAAMQGAYISQYTPVPSSSVSVEESSGQQNQVAVDAPSEHGVYSFQFNK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002889 |
RefSeq Size | 8504 |
RefSeq ORF | 1221 |
Synonyms | SCR3 |
Locus ID | 5939 |
Cytogenetics | 12q13.3 |
Summary | The protein encoded by this gene is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. The RBMS proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. This protein was isolated by phenotypic complementation of cdc2 and cdc13 mutants of yeast and is thought to suppress cdc2 and cdc13 mutants through the induction of translation of cdc2. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419043 | RBMS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419043 | Transient overexpression lysate of RNA binding motif, single stranded interacting protein 2 (RBMS2) |
CNY 3080.00 |
|
TP306581 | Recombinant protein of human RNA binding motif, single stranded interacting protein 2 (RBMS2), 20 µg |
CNY 2900.00 |