PDE1B (NM_000924) Human Mass Spec Standard
CAT#: PH306588
PDE1B MS Standard C13 and N15-labeled recombinant protein (NP_000915)
View other "PDE1B" proteins (5)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
CNY 3080.00
Specifications
| Product Data | |
| Description | PDE1B MS Standard C13 and N15-labeled recombinant protein (NP_000915) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC206588 | 
| Predicted MW | 61.4 kDa | 
| Protein Sequence | 
                 >RC206588 protein sequence 
Red=Cloning site Green=Tags(s) MELSPRSPPEMLEESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEINIEELKKNLEYTASLLEAV YIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQARAKGRRAEEKPKFRSIVHAVQAGIFVERMFR RTYTSVGPTYSTAVLNCLKNLDLWCFDVFSLNQAADDHALRTIVFELLTRHNLISRFKIPTVFLMSFLDA LETGYGKYKNPYHNQIHAADVTQTVHCFLLRTGMVHCLSEIELLAIIFAAAIHDYEHTGTTNSFHIQTKS ECAIVYNDRSVLENHHISSVFRLMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKTMKTAL QQLERIDKPKALSLLLHAADISHPTKQWLVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQS QIGFIDFIVEPTFSVLTDVAEKSVQPLADEDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFRSTWVKRIQ ENKQKWKERAASGITNQMSIDELSPCEEEAPPSPAEDEHNQNGNLD myc-FLAG tag  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_000915 | 
| RefSeq Size | 3463 | 
| RefSeq ORF | 1608 | 
| Synonyms | HEL-S-79p; PDE1B1; PDES1B | 
| Locus ID | 5153 | 
| Cytogenetics | 12q13.2 | 
| Summary | The protein encoded by this gene belongs to the cyclic nucleotide phosphodiesterase (PDE) family, and PDE1 subfamily. Members of the PDE1 family are calmodulin-dependent PDEs that are stimulated by a calcium-calmodulin complex. This PDE has dual-specificity for the second messengers, cAMP and cGMP, with a preference for cGMP as a substrate. cAMP and cGMP function as key regulators of many important physiological processes. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011] | 
| Protein Families | Druggable Genome | 
| Protein Pathways | Calcium signaling pathway, Progesterone-mediated oocyte maturation, Purine metabolism | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC400337 | PDE1B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LC431450 | PDE1B HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY400337 | Transient overexpression lysate of phosphodiesterase 1B, calmodulin-dependent (PDE1B), transcript variant 1 | 
                                                     CNY 3080.00  | 
                                            |
| LY431450 | Transient overexpression lysate of phosphodiesterase 1B, calmodulin-dependent (PDE1B), transcript variant 2 | 
                                                     CNY 3080.00  | 
                                            |
| TP306588 | Recombinant protein of human phosphodiesterase 1B, calmodulin-dependent (PDE1B), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
