Cyclin A1 (CCNA1) (NM_003914) Human Mass Spec Standard
CAT#: PH306615
CCNA1 MS Standard C13 and N15-labeled recombinant protein (NP_003905)
View other "Cyclin A1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CCNA1 MS Standard C13 and N15-labeled recombinant protein (NP_003905) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206615 |
Predicted MW | 52.2 kDa |
Protein Sequence |
>RC206615 protein sequence
Red=Cloning site Green=Tags(s) METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTR APLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDE LEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEY AEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSV LRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQY LRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVP CLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003905 |
RefSeq Size | 1965 |
RefSeq ORF | 1392 |
Synonyms | CT146 |
Locus ID | 8900 |
Cytogenetics | 13q13.3 |
Summary | The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. The cyclin encoded by this gene was shown to be expressed in testis and brain, as well as in several leukemic cell lines, and is thought to primarily function in the control of the germline meiotic cell cycle. This cyclin binds both CDK2 and CDC2 kinases, which give two distinct kinase activities, one appearing in S phase, the other in G2, and thus regulate separate functions in cell cycle. This cyclin was found to bind to important cell cycle regulators, such as Rb family proteins, transcription factor E2F-1, and the p21 family proteins. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Acute myeloid leukemia, Cell cycle, Pathways in cancer, Progesterone-mediated oocyte maturation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401287 | CCNA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401287 | Transient overexpression lysate of cyclin A1 (CCNA1), transcript variant 1 |
CNY 3080.00 |
|
TP306615 | Recombinant protein of human cyclin A1 (CCNA1), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP761134 | Purified recombinant protein of Human cyclin A1 (CCNA1), transcript variant 1, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |
其它Cyclin A1产品