Carbonic Anhydrase I (CA1) (NM_001738) Human Mass Spec Standard
CAT#: PH306616
CA1 MS Standard C13 and N15-labeled recombinant protein (NP_001729)
View other "Carbonic Anhydrase I" proteins (12)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | CA1 MS Standard C13 and N15-labeled recombinant protein (NP_001729) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206616 |
Predicted MW | 28.9 kDa |
Protein Sequence |
>RC206616 protein sequence
Red=Cloning site Green=Tags(s) MASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVN FEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKAD GLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTW IICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001729 |
RefSeq Size | 1319 |
RefSeq ORF | 783 |
Synonyms | CA-I; CAB; Car1; HEL-S-11 |
Locus ID | 759 |
Cytogenetics | 8q21.2 |
Summary | Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016] |
Protein Families | Druggable Genome |
Protein Pathways | Nitrogen metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400658 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426993 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426994 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426995 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431814 | CA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400658 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 2 |
CNY 3080.00 |
|
LY426993 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 1 |
CNY 3080.00 |
|
LY426994 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 3 |
CNY 3080.00 |
|
LY426995 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 4 |
CNY 3080.00 |
|
LY431814 | Transient overexpression lysate of carbonic anhydrase I (CA1), transcript variant 5 |
CNY 3080.00 |
|
TP306616 | Recombinant protein of human carbonic anhydrase I (CA1), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP720088 | Recombinant protein of human carbonic anhydrase I (CA1), transcript variant 1 |
CNY 1800.00 |
其它Carbonic Anhydrase I产品