RABIF (NM_002871) Human Mass Spec Standard
CAT#: PH306632
RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862)
View other "RABIF" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | RABIF MS Standard C13 and N15-labeled recombinant protein (NP_002862) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206632 |
| Predicted MW | 13.8 kDa |
| Protein Sequence |
>RC206632 protein sequence
Red=Cloning site Green=Tags(s) MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWL VEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_002862 |
| RefSeq Size | 3227 |
| RefSeq ORF | 369 |
| Synonyms | MSS4; RASGFR3; RASGRF3 |
| Locus ID | 5877 |
| Cytogenetics | 1q32.1 |
| Summary | This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport. [provided by RefSeq, Oct 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419050 | RABIF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419050 | Transient overexpression lysate of RAB interacting factor (RABIF) |
CNY 3080.00 |
|
| TP306632 | Recombinant protein of human RAB interacting factor (RABIF), 20 µg |
CNY 2900.00 |
