Cytoglobin (CYGB) (NM_134268) Human Mass Spec Standard
CAT#: PH306642
CYGB MS Standard C13 and N15-labeled recombinant protein (NP_599030)
View other "Cytoglobin" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | CYGB MS Standard C13 and N15-labeled recombinant protein (NP_599030) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206642 |
Predicted MW | 21.4 kDa |
Protein Sequence |
>RC206642 protein sequence
Red=Cloning site Green=Tags(s) MEKVPGEMEIERRERSEELSEAERKAVQAMWARLYASCEDVGVAILVRFFVNFPSAKQYFSQFKHMEDPL EMERSPQLRKHACRVMGALNTVVENLHDPDKVSSVLALVGKAHALKHKVEPVYFKILSGVILEVVAEEFA SDFPPETQRAWAKLRGLIYSHVTAAYKEVGWVQQVPNATTPPATLPSSGP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_599030 |
RefSeq Size | 2166 |
RefSeq ORF | 570 |
Synonyms | HGB; STAP |
Locus ID | 114757 |
Cytogenetics | 17q25.1 |
Summary | This gene encodes a globin protein found in vertebrate cells. The encoded protein is described as a hexacoordinate hemoglobin which binds ligand differently from the pentacoordinate hemoglobins involved in oxygen transport, and may be involved in protection during oxidative stress. This gene is located on chromosome 17 in the same region as a retinal gene which is mutated in progressive rod-cone degeneration, but in the opposite orientation. [provided by RefSeq, Jan 2012] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408741 | CYGB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408741 | Transient overexpression lysate of cytoglobin (CYGB) |
CNY 3080.00 |
|
TP306642 | Recombinant protein of human cytoglobin (CYGB), 20 µg |
CNY 2900.00 |
|
TP720611 | Purified recombinant protein of Human cytoglobin (CYGB) |
CNY 1800.00 |
其它Cytoglobin产品