EAN57 (TEX33) (NM_178552) Human Mass Spec Standard
CAT#: PH306729
C22orf33 MS Standard C13 and N15-labeled recombinant protein (NP_848647)
View other "EAN57" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C22orf33 MS Standard C13 and N15-labeled recombinant protein (NP_848647) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206729 |
| Predicted MW | 21.8 kDa |
| Protein Sequence |
>RC206729 protein sequence
Red=Cloning site Green=Tags(s) MDPQSRSLKNAGSRSSSRENRATSGEGAQPCQGTDDGPSLGAQDQRSTPTNQKGSIIPNNIRHKFGSNVV DQLVSEEQAQKAIDEVFEGQKRASSWPSRTQNPVEISSVFSDYYDLGYNMRSNLFRGAAEETKSLMKASY TPEVIEKSVRDLEHWHGRKTDDLGRWHQKNAMNLNLQKALEEKYGENSKSKSSKY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_848647 |
| RefSeq Size | 1030 |
| RefSeq ORF | 585 |
| Synonyms | C22orf33; cE81G9.2; EAN57 |
| Locus ID | 339669 |
| Cytogenetics | 22q12.3 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405921 | TEX33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431239 | TEX33 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405921 | Transient overexpression lysate of chromosome 22 open reading frame 33 (C22orf33), transcript variant 2 |
CNY 3080.00 |
|
| LY431239 | Transient overexpression lysate of chromosome 22 open reading frame 33 (C22orf33), transcript variant 1 |
CNY 3080.00 |
|
| TP306729 | Recombinant protein of human chromosome 22 open reading frame 33 (C22orf33), 20 µg |
CNY 2900.00 |
