MS4A15 (NM_152717) Human Mass Spec Standard
CAT#: PH306747
MS4A15 MS Standard C13 and N15-labeled recombinant protein (NP_689930)
View other "MS4A15" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | MS4A15 MS Standard C13 and N15-labeled recombinant protein (NP_689930) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206747 |
| Predicted MW | 15.4 kDa |
| Protein Sequence |
>RC206747 protein sequence
Red=Cloning site Green=Tags(s) MVRRGHVGIFFIEGGVPFWGGACFIISGSLSVAAEKNHTSCLVRSSLGTNILSVMAAFAGTAILLMDFGV TNRDVDRGYLAVLTIFTVLEFFTAVIAMHFGCQAIHAQASAPVIFLPNAFSADFNIPSPAASAPPAYDNV AYAQGVV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_689930 |
| RefSeq Size | 1693 |
| RefSeq ORF | 441 |
| Locus ID | 219995 |
| Cytogenetics | 11q12.2 |
| Summary | May be involved in signal transduction as a component of a multimeric receptor complex.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407337 | MS4A15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407337 | Transient overexpression lysate of membrane-spanning 4-domains, subfamily A, member 15 (MS4A15), transcript variant 2 |
CNY 3080.00 |
|
| TP306747 | Recombinant protein of human membrane-spanning 4-domains, subfamily A, member 15 (MS4A15), transcript variant 2, 20 µg |
CNY 2900.00 |
