SENP8 (NM_145204) Human Mass Spec Standard
CAT#: PH306791
SENP8 MS Standard C13 and N15-labeled recombinant protein (NP_660205)
View other "SENP8" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | SENP8 MS Standard C13 and N15-labeled recombinant protein (NP_660205) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206791 |
Predicted MW | 24.1 kDa |
Protein Sequence |
>RC206791 protein sequence
Red=Cloning site Green=Tags(s) MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAE IAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFL GRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLA KK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_660205 |
RefSeq Size | 1569 |
RefSeq ORF | 636 |
Synonyms | DEN1; NEDP1; PRSC2 |
Locus ID | 123228 |
Cytogenetics | 15q23 |
Summary | This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407943 | SENP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC432692 | SENP8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY407943 | Transient overexpression lysate of SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 2 |
CNY 3080.00 |
|
LY432692 | Transient overexpression lysate of SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1 |
CNY 3080.00 |
|
TP306791 | Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), 20 µg |
CNY 2900.00 |
|
TP329692 | Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP720150 | Recombinant protein of human SUMO/sentrin specific peptidase family member 8 (SENP8), transcript variant 1. |
CNY 1800.00 |