TFE3 (NM_006521) Human Mass Spec Standard
CAT#: PH306840
TFE3 MS Standard C13 and N15-labeled recombinant protein (NP_006512)
View other "TFE3" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TFE3 MS Standard C13 and N15-labeled recombinant protein (NP_006512) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC206840 |
| Predicted MW | 61.5 kDa |
| Protein Sequence |
>RC206840 protein sequence
Red=Cloning site Green=Tags(s) MSHAAEPARDGVEASAEGPRAVFVLLEERRPADSAQLLSLNSLLPESGIVADIELENVLDPDSFYELKSQ PLPLRSSLPISLQATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMRAQAQEQERRERREQAAAA PFPSPAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPK LASQALTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIGSSSEKEIDDVIDEIISLESSYNDEML SYLPGGTTGLQLPSTLPVSGNLLDVYSSQGVATPAITVSNSCPAELPNIKREISETEAKALLKERQKKDN HNLIERRRRFNINDRIKELGTLIPKSSDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQAN RSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQ QPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGALSPLRAASDPLLSSVSPAVS KASSRRSSFSMEEES myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006512 |
| RefSeq Size | 3467 |
| RefSeq ORF | 1725 |
| Synonyms | bHLHe33; RCCP2; RCCX1; TFEA |
| Locus ID | 7030 |
| Cytogenetics | Xp11.23 |
| Summary | This gene encodes a basic helix-loop-helix domain-containing transcription factor that binds MUE3-type E-box sequences in the promoter of genes. The encoded protein promotes the expression of genes downstream of transforming growth factor beta (TGF-beta) signaling. This gene may be involved in chromosomal translocations in renal cell carcinomas and other cancers, resulting in the production of fusion proteins. Translocation partners include PRCC (papillary renal cell carcinoma), NONO (non-POU domain containing, octamer-binding), and ASPSCR1 (alveolar soft part sarcoma chromosome region, candidate 1), among other genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Families | Druggable Genome, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416587 | TFE3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416587 | Transient overexpression lysate of transcription factor binding to IGHM enhancer 3 (TFE3) |
CNY 3080.00 |
|
| TP306840 | Recombinant protein of human transcription factor binding to IGHM enhancer 3 (TFE3), 20 µg |
CNY 2900.00 |
|
| TP710034 | Recombinant protein of human transcription factor binding to IGHM enhancer 3 (TFE3),with N-terminal polyhistidine tag, expressed in sf9 cells. |
CNY 4020.00 |
|
| TP762495 | Purified recombinant protein of Human transcription factor binding to IGHM enhancer 3 (TFE3), 322Cys-End, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 2150.00 |
