PAK4 (NM_001014831) Human Mass Spec Standard
CAT#: PH306847
PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014831)
View other "PAK4" proteins (15)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 1999.00
CNY 2700.00
CNY 3080.00
Specifications
Product Data | |
Description | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014831) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206847 |
Predicted MW | 64.1 kDa |
Protein Sequence |
>RC206847 protein sequence
Red=Cloning site Green=Tags(s) MFGKRKKRVEISAPSNFEHRVHTGFDQHEQKFTGLPRQWQSLIEESARRPKPLVDPACITSIQPGAPKTI VRGSKGAKDGALTLLLDEFENMSVTRSNSLRRDSPPPPARARQENGMPEEPATTARGGPGKAGSRGRFAG HSEAGGGSGDRRRAGPEKRPKSSREGSGGPQESSRDKRPLSGPDVGTPQPAGLASGAKLAAGRPFNTYPR ADTDHPSRGAQGEPHDVAPNGPSAGGLAIPQSSSSSSRPPTRARGAPSPGVLGPHASEPQLAPPACTPAA PAVPGPPGPRSPQREPQRVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVK KMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAV CLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRL PYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQR ATAAELLKHPFLAKAGPPASIVPLMRQNRTR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001014831 |
RefSeq Size | 3064 |
RefSeq ORF | 1773 |
Locus ID | 10298 |
Cytogenetics | 19q13.2 |
Summary | PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Axon guidance, ErbB signaling pathway, Focal adhesion, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417002 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423086 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423087 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423088 | PAK4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY417002 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1 |
CNY 3080.00 |
|
LY423086 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2 |
CNY 3080.00 |
|
LY423087 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3 |
CNY 3080.00 |
|
LY423088 | Transient overexpression lysate of p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 5 |
CNY 4840.00 |
|
PH302302 | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_005875) |
CNY 19520.00 |
|
PH317097 | PAK4 MS Standard C13 and N15-labeled recombinant protein (NP_001014832) |
CNY 19520.00 |
|
TP302302 | Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP306847 | Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP317097 | Recombinant protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP723905 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 10 µg |
CNY 8025.00 |
|
TP723906 | Purified recombinant kinase domain protein of human p21 protein (Cdc42/Rac)-activated kinase 4 (PAK4), transcript variant 1, 100 µg |
CNY 30956.00 |