Kisspeptin (KISS1) (NM_002256) Human Mass Spec Standard
CAT#: PH306859
KISS1 MS Standard C13 and N15-labeled recombinant protein (NP_002247)
View other "Kisspeptin" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Cited in 1 publication. |
Specifications
Product Data | |
Description | KISS1 MS Standard C13 and N15-labeled recombinant protein (NP_002247) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206859 |
Predicted MW | 14.7 kDa |
Protein Sequence |
>RC206859 protein sequence
Red=Cloning site Green=Tags(s) MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTS LSPPPESSGSPQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002247 |
RefSeq Size | 731 |
RefSeq ORF | 414 |
Synonyms | HH13; KiSS-1 |
Locus ID | 3814 |
Cytogenetics | 1q32.1 |
Summary | This gene is a metastasis suppressor gene that suppresses metastases of melanomas and breast carcinomas without affecting tumorigenicity. The encoded protein may inhibit chemotaxis and invasion and thereby attenuate metastasis in malignant melanomas. Studies suggest a putative role in the regulation of events downstream of cell-matrix adhesion, perhaps involving cytoskeletal reorganization. A protein product of this gene, kisspeptin, stimulates gonadotropin-releasing hormone (GnRH)-induced gonadotropin secretion and regulates the pubertal activation of GnRH nuerons. A polymorphism in the terminal exon of this mRNA results in two protein isoforms. An adenosine present at the polymorphic site represents the third position in a stop codon. When the adenosine is absent, a downstream stop codon is utilized and the encoded protein extends for an additional seven amino acid residues. [provided by RefSeq, Mar 2012] |
Protein Families | Druggable Genome, Secreted Protein |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The Role of Neurotransmitters in Protection against Amyloid-β Toxicity by KiSS-1 Overexpression in SH-SY5Y Neurons
,null,
ISRN Neuroscience
,PubMed ID 24967306
[KISS1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400819 | KISS1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400819 | Transient overexpression lysate of KiSS-1 metastasis-suppressor (KISS1) |
CNY 3080.00 |
|
TP306859 | Recombinant protein of human KiSS-1 metastasis-suppressor (KISS1), 20 µg |
CNY 2900.00 |
其它Kisspeptin产品