ACBD5 (NM_001042473) Human Mass Spec Standard
CAT#: PH307033
ACBD5 MS Standard C13 and N15-labeled recombinant protein (NP_001035938)
View other "ACBD5" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | ACBD5 MS Standard C13 and N15-labeled recombinant protein (NP_001035938) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207033 |
| Predicted MW | 54.8 kDa |
| Protein Sequence |
>RC207033 protein sequence
Red=Cloning site Green=Tags(s) MADTRSVHETRFEAAVKVIQSLPKNGSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWS SLGDMTKEEAMIAYVEEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITSDLGNVLTSTPNA KTVNGKAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQNDIHA SSSLNGRSTEEVKPIDENLGQTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEVYCDSMEQFGQEESLD SFTSNNGPFQYYLGGHSSQPMENSGFREDIQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNSGAPHRE KRGGETDEFSNVRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVL QRLQKLETLTALQAKSSTSTLQTAPQPTSQRPSWWPFEMSPGVLTFAIIWPFIAQWLVYLYYQRRRRKLN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001035938 |
| RefSeq Size | 3871 |
| RefSeq ORF | 1470 |
| Synonyms | RDLKD |
| Locus ID | 91452 |
| Cytogenetics | 10p12.1 |
| Summary | This gene encodes a member of the acyl-Coenzyme A binding protein family, known to function in the transport and distribution of long chain acyl-Coenzyme A in cells. This gene may play a role in the differentiation of megakaryocytes and formation of platelets. A related protein in yeast is involved in autophagy of peroxisomes. A mutation in this gene has been associated with autosomal dominant thrombocytopenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC420927 | ACBD5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY420927 | Transient overexpression lysate of acyl-Coenzyme A binding domain containing 5 (ACBD5), transcript variant 2 |
CNY 3080.00 |
|
| TP307033 | Recombinant protein of human acyl-Coenzyme A binding domain containing 5 (ACBD5), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP312795 | Recombinant protein of human acyl-Coenzyme A binding domain containing 5 (ACBD5), transcript variant 1, 20 µg |
CNY 2900.00 |

