ACYP1 (NM_001107) Human Mass Spec Standard
CAT#: PH307110
ACYP1 MS Standard C13 and N15-labeled recombinant protein (NP_001098)
View other "ACYP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | ACYP1 MS Standard C13 and N15-labeled recombinant protein (NP_001098) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207110 |
Predicted MW | 11.3 kDa |
Protein Sequence |
>RC207110 protein sequence
Red=Cloning site Green=Tags(s) MAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRG SPKSHIDKANFNNEKVILKLDYSDFQIVK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001098 |
RefSeq Size | 621 |
RefSeq ORF | 297 |
Synonyms | ACYPE |
Locus ID | 97 |
Cytogenetics | 14q24.3 |
Summary | This gene is a member of the acylphosphatase family. The encoded protein is a small cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two isoenzymes have been isolated and described based on their tissue localization: erythrocyte (common) type acylphosphatase encoded by this gene, and muscle type acylphosphatase. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014] |
Protein Pathways | Pyruvate metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420125 | ACYP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY420125 | Transient overexpression lysate of acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1 |
CNY 3080.00 |
|
TP307110 | Recombinant protein of human acylphosphatase 1, erythrocyte (common) type (ACYP1), transcript variant 1, 20 µg |
CNY 2900.00 |