PRKACB (NM_002731) Human Mass Spec Standard
CAT#: PH307218
PRKACB MS Standard C13 and N15-labeled recombinant protein (NP_002722)
View other "PRKACB" proteins (6)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | PRKACB MS Standard C13 and N15-labeled recombinant protein (NP_002722) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207218 |
Predicted MW | 40.6 kDa |
Protein Sequence |
>RC207218 protein sequence
Red=Cloning site Green=Tags(s) MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYY AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFS EPHARFYAAQIVLTFEYLNSLDIIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSNFSSDLKDLLRNLLQVDLTK RFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGE F myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002722 |
RefSeq Size | 4616 |
RefSeq ORF | 1053 |
Synonyms | CAFD2; PKA C-beta; PKACB |
Locus ID | 5567 |
Cytogenetics | 1p31.1 |
Summary | The protein encoded by this gene is a member of the serine/threonine protein kinase family. The encoded protein is a catalytic subunit of cAMP (cyclic AMP)-dependent protein kinase, which mediates signalling though cAMP. cAMP signaling is important to a number of processes, including cell proliferaton and differentiation. Multiple alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Apoptosis, Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Hedgehog signaling pathway, Insulin signaling pathway, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Olfactory transduction, Oocyte meiosis, Prion diseases, Progesterone-mediated oocyte maturation, Taste transduction, Vascular smooth muscle contraction, Vibrio cholerae infection, Wnt signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403923 | PRKACB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419141 | PRKACB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403923 | Transient overexpression lysate of protein kinase, cAMP-dependent, catalytic, beta (PRKACB), transcript variant 3 |
CNY 3080.00 |
|
LY419141 | Transient overexpression lysate of protein kinase, cAMP-dependent, catalytic, beta (PRKACB), transcript variant 2 |
CNY 3080.00 |
|
TP307218 | Recombinant protein of human protein kinase, cAMP-dependent, catalytic, beta (PRKACB), transcript variant 2, 20 µg |
CNY 2900.00 |
|
TP761790 | Purified recombinant protein of Human protein kinase, cAMP-dependent, catalytic, beta (PRKACB), transcript variant 3, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug |
CNY 2040.00 |