TMEM188 (CNEP1R1) (NM_153261) Human Mass Spec Standard
CAT#: PH307243
TMEM188 MS Standard C13 and N15-labeled recombinant protein (NP_694993)
View other "TMEM188" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | TMEM188 MS Standard C13 and N15-labeled recombinant protein (NP_694993) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207243 |
| Predicted MW | 16 kDa |
| Protein Sequence |
>RC207243 protein sequence
Red=Cloning site Green=Tags(s) MNSLEQAEAPRVVSLIPAVVSGNCQDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDP ETQKVSFFTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKPRPH VQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_694993 |
| RefSeq Size | 2201 |
| RefSeq ORF | 426 |
| Synonyms | C16orf69; NEP1-R1; NEP1R1; TMEM188; TMP125 |
| Locus ID | 255919 |
| Cytogenetics | 16q12.1 |
| Summary | This gene encodes a transmembrane protein that belongs to the Tmemb_18A family. A similar protein in yeast is a component of an endoplasmic reticulum-associated protein phosphatase complex and is thought to play a role in the synthesis of triacylglycerol. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407111 | CNEP1R1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407111 | Transient overexpression lysate of transmembrane protein 188 (TMEM188) |
CNY 3080.00 |
|
| TP307243 | Recombinant protein of human transmembrane protein 188 (TMEM188), 20 µg |
CNY 2900.00 |
其它TMEM188产品
