BID (NM_001196) Human Mass Spec Standard
CAT#: PH307261
BID MS Standard C13 and N15-labeled recombinant protein (NP_001187)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | BID MS Standard C13 and N15-labeled recombinant protein (NP_001187) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207261 |
| Predicted MW | 26.8 kDa |
| Protein Sequence |
>RC207261 protein sequence
Red=Cloning site Green=Tags(s) MCSGAGVMMARWAARGRAGWRSTVRILSPLGHCEPGVSRSCRAAQAMDCEVNNGSSLRDECITNLLVFGF LQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVG DSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASQTP SLLRDVFHTTVNFINQNLRTYVRSLARNGMD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001187 |
| RefSeq Size | 2217 |
| RefSeq ORF | 723 |
| Synonyms | FP497 |
| Locus ID | 637 |
| Cytogenetics | 22q11.21 |
| Summary | This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2, and thus regulate apoptosis. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found. [provided by RefSeq, Aug 2020] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alzheimer's disease, Amyotrophic lateral sclerosis (ALS), Apoptosis, Natural killer cell mediated cytotoxicity, p53 signaling pathway, Pathways in cancer, Viral myocarditis |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC405092 | BID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420074 | BID HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY405092 | Transient overexpression lysate of BH3 interacting domain death agonist (BID), transcript variant 3 |
CNY 3080.00 |
|
| LY420074 | Transient overexpression lysate of BH3 interacting domain death agonist (BID), transcript variant 2 |
CNY 3080.00 |
|
| TP307261 | Recombinant protein of human BH3 interacting domain death agonist (BID), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP720087 | Recombinant protein of human BH3 interacting domain death agonist (BID), transcript variant 2 |
CNY 1800.00 |
|
| TP760319 | Recombinant protein of human BH3 interacting domain death agonist (BID), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2040.00 |
