PLEKHA1 (NM_021622) Human Mass Spec Standard
CAT#: PH307285
PLEKHA1 MS Standard C13 and N15-labeled recombinant protein (NP_067635)
View other "PLEKHA1" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PLEKHA1 MS Standard C13 and N15-labeled recombinant protein (NP_067635) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207285 |
| Predicted MW | 45.6 kDa |
| Protein Sequence |
>RC207285 protein sequence
Red=Cloning site Green=Tags(s) MPYVDRQNRICGFLDIEENENSGKFLRRYFILDTREDSFVWYMDNPQNLPSGSSRVGAIKLTYISKVSDA TKLRPKAEFCFVMNAGMRKYFLQANDQQDLVEWVNVLNKAIKITVPKQSDSQPNSDNLSRHGECGKKQVS YRTDIVGGVPIITPTQKEEVNECGESIDRNNLKRSQSHLPYFTPKPPQDSAVIKAGYCVKQGAVMKNWKR RYFQLDENTIGYFKSELEKEPLRVIPLKEVHKVQECKQSDIMMRDNLFEIVTTSRTFYVQADSPEEMHSW IKAVSGAIVAQRGPGRSASSEHPPGPSESKHAFRPTNAATATSHSTASRSNSLVSTFTMEKRGFYESLAK VKPGNFKVQTVSPREPASKVTEQALLRPQSKNGPQEKDCDLVDLDDASLPVSDV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_067635 |
| RefSeq Size | 3732 |
| RefSeq ORF | 1212 |
| Synonyms | TAPP1 |
| Locus ID | 59338 |
| Cytogenetics | 10q26.13 |
| Summary | This gene encodes a pleckstrin homology domain-containing adapter protein. The encoded protein is localized to the plasma membrane where it specifically binds phosphatidylinositol 3,4-bisphosphate. This protein may be involved in the formation of signaling complexes in the plasma membrane. Polymorphisms in this gene are associated with age-related macular degeneration. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 5.[provided by RefSeq, Sep 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411973 | PLEKHA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424303 | PLEKHA1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411973 | Transient overexpression lysate of pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 (PLEKHA1), transcript variant 1 |
CNY 3080.00 |
|
| LY424303 | Transient overexpression lysate of pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 (PLEKHA1), transcript variant 2 |
CNY 3080.00 |
|
| TP307285 | Recombinant protein of human pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 1 (PLEKHA1), transcript variant 1, 20 µg |
CNY 2900.00 |
其它PLEKHA1产品


