JPT1 (NM_001002033) Human Mass Spec Standard
CAT#: PH307344
HN1 MS Standard C13 and N15-labeled recombinant protein (NP_001002033)
View other "JPT1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
Product Data | |
Description | HN1 MS Standard C13 and N15-labeled recombinant protein (NP_001002033) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207344 |
Predicted MW | 11 kDa |
Protein Sequence |
>RC207344 protein sequence
Red=Cloning site Green=Tags(s) MASNIFGTPEENQASWAKSAGAKSSGGREDLESSGLQRRNSSEASSGDFLDLKGEGDIHENVDTDLPGSL GQSEEKPVPAAPVPSPVAPAPVPSRRNPPGGKSSLVLG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001002033 |
RefSeq Size | 1705 |
RefSeq ORF | 324 |
Synonyms | ARM2; HN1; HN1A |
Locus ID | 51155 |
Cytogenetics | 17q25.1 |
Summary | Modulates negatively AKT-mediated GSK3B signaling (PubMed:21323578, PubMed:22155408). Induces CTNNB1 'Ser-33' phosphorylation and degradation through the suppression of the inhibitory 'Ser-9' phosphorylation of GSK3B, which represses the function of the APC:CTNNB1:GSK3B complex and the interaction with CDH1/E-cadherin in adherent junctions (PubMed:25169422). Plays a role in the regulation of cell cycle and cell adhesion (PubMed:25169422, PubMed:25450365). Has an inhibitory role on AR-signaling pathway through the induction of receptor proteosomal degradation (PubMed:22155408).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414136 | HN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424172 | HN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY414136 | Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 1 |
CNY 3080.00 |
|
LY424172 | Transient overexpression lysate of hematological and neurological expressed 1 (HN1), transcript variant 3 |
CNY 3080.00 |
|
PH321865 | HN1 MS Standard C13 and N15-labeled recombinant protein (NP_057269) |
CNY 19520.00 |
|
TP307344 | Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 3, 20 µg |
CNY 2900.00 |
|
TP321865 | Recombinant protein of human hematological and neurological expressed 1 (HN1), transcript variant 1, 20 µg |
CNY 2900.00 |