DHDH (NM_014475) Human Mass Spec Standard
CAT#: PH307537
DHDH MS Standard C13 and N15-labeled recombinant protein (NP_055290)
View other "DHDH" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DHDH MS Standard C13 and N15-labeled recombinant protein (NP_055290) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207537 |
| Predicted MW | 36.4 kDa |
| Protein Sequence |
>RC207537 protein sequence
Red=Cloning site Green=Tags(s) MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVA YIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLA QGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDD TVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFD NGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_055290 |
| RefSeq Size | 1098 |
| RefSeq ORF | 1002 |
| Synonyms | 2DD; HUM2DD |
| Locus ID | 27294 |
| Cytogenetics | 19q13.33 |
| Summary | This gene encodes an enzyme that belongs to the family of dihydrodiol dehydrogenases, which exist in multiple forms in mammalian tissues and are involved in the metabolism of xenobiotics and sugars. These enzymes catalyze the NADP1-linked oxidation of transdihydrodiols of aromatic hydrocarbons to corresponding catechols. This enzyme is a dimeric dihydrodiol dehydrogenase, and it differs from monomeric dihydrodiol dehydrogenases in its high substrate specificity for trans-dihydrodiols of aromatic hydrocarbons in the oxidative direction. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Metabolism of xenobiotics by cytochrome P450 |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415257 | DHDH HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415257 | Transient overexpression lysate of dihydrodiol dehydrogenase (dimeric) (DHDH) |
CNY 3080.00 |
|
| TP307537 | Recombinant protein of human dihydrodiol dehydrogenase (dimeric) (DHDH), 20 µg |
CNY 2900.00 |
