BST2 (NM_004335) Human Mass Spec Standard
CAT#: PH307540
BST2 MS Standard C13 and N15-labeled recombinant protein (NP_004326)
View other "BST2" proteins (3)
| 
                   Need it in bulk or customized?  Get a free quote  | 
                    
CNY 19520.00
Specifications
| Product Data | |
| Description | BST2 MS Standard C13 and N15-labeled recombinant protein (NP_004326) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC207540 | 
| Predicted MW | 19.8 kDa | 
| Protein Sequence | 
                 >RC207540 protein sequence 
Red=Cloning site Green=Tags(s) MASTSYDYCRVPMEDGDKRCKLLLGIGILVLLIIVILGVPLIIFTIKANSEACRDGLRAVMECRNVTHLL QQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRE NQVLSVRIADKKYYPSSQDSSSAAAPQLLIVLLGLSALLQ SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV  | 
        
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_004326 | 
| RefSeq Size | 1048 | 
| RefSeq ORF | 540 | 
| Synonyms | CD317; HM1.24; TETHERIN | 
| Locus ID | 684 | 
| Cytogenetics | 19p13.11 | 
| Summary | Bone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis. [provided by RefSeq, Jul 2008] | 
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401380 | BST2 HEK293T cell transient overexpression lysate (as WB positive control) | 
                                                     CNY 900.00  | 
                                            |
| LY401380 | Transient overexpression lysate of bone marrow stromal cell antigen 2 (BST2) | 
                                                     CNY 3080.00  | 
                                            |
| TP307540 | Recombinant protein of human bone marrow stromal cell antigen 2 (BST2), 20 µg | 
                                                     
                                                        
                                                        
                                                        
                                                            CNY 2900.00  | 
                                            
