Dermatopontin (DPT) (NM_001937) Human Mass Spec Standard
CAT#: PH307588
DPT MS Standard C13 and N15-labeled recombinant protein (NP_001928)
View other "Dermatopontin" proteins (4)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | DPT MS Standard C13 and N15-labeled recombinant protein (NP_001928) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207588 |
| Predicted MW | 24 kDa |
| Protein Sequence |
>RC207588 protein sequence
Red=Cloning site Green=Tags(s) MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSD RQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCP YSCWLTIEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001928 |
| RefSeq Size | 1749 |
| RefSeq ORF | 603 |
| Synonyms | TRAMP |
| Locus ID | 1805 |
| Cytogenetics | 1q24.2 |
| Summary | Dermatopontin is an extracellular matrix protein with possible functions in cell-matrix interactions and matrix assembly. The protein is found in various tissues and many of its tyrosine residues are sulphated. Dermatopontin is postulated to modify the behavior of TGF-beta through interaction with decorin. [provided by RefSeq, Jul 2008] |
| Protein Families | Secreted Protein |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419639 | DPT HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419639 | Transient overexpression lysate of dermatopontin (DPT) |
CNY 3080.00 |
|
| TP307588 | Recombinant protein of human dermatopontin (DPT), 20 µg |
CNY 2900.00 |
|
| TP721061 | Purified recombinant protein of Human dermatopontin (DPT) |
CNY 1800.00 |
其它Dermatopontin产品
