CAMK1D (NM_153498) Human Mass Spec Standard
CAT＃: PH307736
CAMK1D MS Standard C13 and N15-labeled recombinant protein (NP_705718)
View other "CAMK1D" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | CAMK1D MS Standard C13 and N15-labeled recombinant protein (NP_705718) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207736 |
| Predicted MW | 42.9 kDa |
| Protein Sequence |
>RC207736 protein sequence
Red=Cloning site Green=Tags(s) MARENGESSSSWKKQAEDIKKIFEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKALKGKESSIENEI AVLRKIKHENIVALEDIYESPNHLYLVMQLVSGGELFDRIVEKGFYTEKDASTLIRQVLDAVYYLHRMGI VHRDLKPENLLYYSQDEESKIMISDFGLSKMEGKGDVMSTACGTPGYVAPEVLAQKPYSKAVDCWSIGVI AYILLCGYPPFYDENDSKLFEQILKAEYEFDSPYWDDISDSAKDFIRNLMEKDPNKRYTCEQAARHPWIA GDTALNKNIHESVSAQIRKNFAKSKWRQAFNATAVVRHMRKLHLGSSLDSSNASVSSSLSLASQKDCLAP STLCSFISSSSGVSGVGAERRPRPTTVTAVHSGSK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_705718 |
| RefSeq Size | 2242 |
| RefSeq ORF | 1155 |
| Synonyms | CaM-K1; CaMKID; CKLiK |
| Locus ID | 57118 |
| Cytogenetics | 10p13 |
| Summary | This gene is a member of the calcium/calmodulin-dependent protein kinase 1 family, a subfamily of the serine/threonine kinases. The encoded protein is a component of the calcium-regulated calmodulin-dependent protein kinase cascade. It has been associated with multiple processes including regulation of granulocyte function, activation of CREB-dependent gene transcription, aldosterone synthesis, differentiation and activation of neutrophil cells, and apoptosis of erythroleukemia cells. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. [provided by RefSeq, Jan 2015] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407015 | CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412500 | CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429619 | CAMK1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY407015 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2 |
CNY 3080.00 |
|
| LY412500 | Transient overexpression lysate of calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 1 |
CNY 3080.00 |
|
| TP307736 | Recombinant protein of human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2, 20 µg |
CNY 2900.00 |
|
| TP721028 | Purified recombinant protein of Human calcium/calmodulin-dependent protein kinase ID (CAMK1D), transcript variant 2 |
CNY 1800.00 |
