NT5M (NM_020201) Human Mass Spec Standard
CAT#: PH307737
NT5M MS Standard C13 and N15-labeled recombinant protein (NP_064586)
View other "NT5M" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NT5M MS Standard C13 and N15-labeled recombinant protein (NP_064586) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207737 |
| Predicted MW | 25.9 kDa |
| Protein Sequence |
>RC207737 protein sequence
Red=Cloning site Green=Tags(s) MIRLGGWCARRLCSAAVPAGRRGAAGGLGLAGGRALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALE DRRGFWVSEQYGRLRPGLSEKAISIWESKNFFFELEPLPGAVEAVKEMASLQNTDVFICTSPIKMFKYCP YEKYAWVEKYFGPDFLEQIVLTRDKTVVSADLLIDDRPDITGAEPTPSWEHVLFTACHNQHLQLQPPRRR LHSWADDWKAILDSKRPC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064586 |
| RefSeq Size | 1633 |
| RefSeq ORF | 684 |
| Synonyms | dNT-2; dNT2; mdN |
| Locus ID | 56953 |
| Cytogenetics | 17p11.2 |
| Summary | This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC412623 | NT5M HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY412623 | Transient overexpression lysate of 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein |
CNY 3080.00 |
|
| TP307737 | Recombinant protein of human 5',3'-nucleotidase, mitochondrial (NT5M), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
