cIAP2 (BIRC3) (NM_001165) Human Mass Spec Standard
CAT#: PH307764
BIRC3 MS Standard C13 and N15-labeled recombinant protein (NP_001156)
View other "cIAP2" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
CNY 1999.00
CNY 2700.00
Specifications
Product Data | |
Description | BIRC3 MS Standard C13 and N15-labeled recombinant protein (NP_001156) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207764 |
Predicted MW | 68.4 kDa |
Protein Sequence |
>RC207764 protein sequence
Red=Cloning site Green=Tags(s) MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGVNDKVKCFCCG LMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNSTHSLLPGTENSGYFRGSYSN SPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWPLTFLSPTDLAKAGFYYIGPGDRVACFACGG KLSNWEPKDNAMSEHLRHFPKCPFIENQLQDTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAG FYYVGNSDDVKCFCCDGGLRCWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSD SPGDENAESSIIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHDVIKQKTQTSL QARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVSDLPVEEQLRRLQEERTCKVC MDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVRTFLS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001156 |
RefSeq Size | 6932 |
RefSeq ORF | 1812 |
Synonyms | AIP1; API2; c-IAP2; CIAP2; HAIP1; HIAP1; IAP-1; MALT2; MIHC; RNF49 |
Locus ID | 330 |
Cytogenetics | 11q22.2 |
Summary | This gene encodes a member of the IAP family of proteins that inhibit apoptosis by binding to tumor necrosis factor receptor-associated factors TRAF1 and TRAF2, probably by interfering with activation of ICE-like proteases. The encoded protein inhibits apoptosis induced by serum deprivation but does not affect apoptosis resulting from exposure to menadione, a potent inducer of free radicals. It contains 3 baculovirus IAP repeats and a ring finger domain. Transcript variants encoding the same isoform have been identified. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome |
Protein Pathways | Apoptosis, Focal adhesion, NOD-like receptor signaling pathway, Pathways in cancer, Small cell lung cancer, Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405280 | BIRC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420093 | BIRC3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY405280 | Transient overexpression lysate of baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 2 |
CNY 3080.00 |
|
LY420093 | Transient overexpression lysate of baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 1 |
CNY 3080.00 |
|
PH311599 | BIRC3 MS Standard C13 and N15-labeled recombinant protein (NP_892007) |
CNY 19520.00 |
|
TP307764 | Recombinant protein of human baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 1, 20 µg |
CNY 2900.00 |
|
TP311599 | Recombinant protein of human baculoviral IAP repeat-containing 3 (BIRC3), transcript variant 2, 20 µg |
CNY 2900.00 |