Interferon regulatory factor 9 (IRF9) (NM_006084) Human Mass Spec Standard
CAT#: PH307768
IRF9 MS Standard C13 and N15-labeled recombinant protein (NP_006075)
View other "Interferon regulatory factor 9" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | IRF9 MS Standard C13 and N15-labeled recombinant protein (NP_006075) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC207768 |
| Predicted MW | 43.7 kDa |
| Protein Sequence |
>RC207768 protein sequence
Red=Cloning site Green=Tags(s) MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYK EGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSS ERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF LLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGIL VASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLN FWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_006075 |
| RefSeq Size | 1699 |
| RefSeq ORF | 1179 |
| Synonyms | IRF-9; ISGF3; ISGF3G; p48 |
| Locus ID | 10379 |
| Cytogenetics | 14q12 |
| Summary | This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65. [provided by RefSeq, Jul 2020] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Jak-STAT signaling pathway |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401832 | IRF9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401832 | Transient overexpression lysate of interferon regulatory factor 9 (IRF9) |
CNY 3080.00 |
|
| TP307768 | Recombinant protein of human interferon regulatory factor 9 (IRF9), 20 µg |
CNY 2900.00 |
其它Interferon regulatory factor 9产品
