SIGLECL1 (SIGLEC12) (NM_053003) Human Mass Spec Standard
CAT#: PH307808
SIGLEC12 MS Standard C13 and N15-labeled recombinant protein (NP_443729)
View other "SIGLECL1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 14250.00
Specifications
Product Data | |
Description | SIGLEC12 MS Standard C13 and N15-labeled recombinant protein (NP_443729) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207808 |
Predicted MW | 65 kDa |
Protein Sequence |
>RC207808 protein sequence
Red=Cloning site Green=Tags(s) MLLLLLLLPPLLCGRVGAKEQKDYLLTMQKSVTVQEGLCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHV SRNIPVATNNPARAVQEETRDRFHLLGDPQNKDCTLSIRDTRESDAGTYVFCVERGNMKWNYKYDQLSVN VTASQDLLSRYRLEVPESVTVQEGLCVSVPCSVLYPHYNWTASSPVYGSWFKEGADIPWDIPVATNTPSG KVQEDTHGRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVHVTALTHMPTFSIP GTLESGHPRNLTCSVPWACEQGTPPTITWMGASVSSLDPTITRSSMLSLIPQPQDHGTSLTCQVTLPGAG VTMTRAVRLNISYPPQNLTMTVFQGDGTASTTLRNGSALSVLEGQSLHLVCAVDSNPPARLSWTWGSLTL SPSQSSNLGVLELPRVHVKDEGEFTCRAQNPLGSQHISLSLSLQNEYTGKMRPISGVTLGAFGGAGATAL VFLYFCIIFVVVRSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPADDSPPHHAPPALATPSPEE GEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_443729 |
RefSeq Size | 2258 |
RefSeq ORF | 1785 |
Synonyms | S2V; Siglec-XII; SIGLECL1; SLG |
Locus ID | 89858 |
Cytogenetics | 19q13.41 |
Summary | Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409355 | SIGLEC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409587 | SIGLEC12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
LY409355 | Transient overexpression lysate of sialic acid binding Ig-like lectin 12 (SIGLEC12), transcript variant 1 |
CNY 3080.00 |
|
LY409587 | Transient overexpression lysate of sialic acid binding Ig-like lectin 12 (SIGLEC12), transcript variant 2 |
CNY 4840.00 |
|
TP307808 | Recombinant protein of human sialic acid binding Ig-like lectin 12 (SIGLEC12), transcript variant 1, 20 µg |
CNY 2900.00 |
其它SIGLECL1产品