SDF1 (CXCL12) (NM_199168) Human Mass Spec Standard
CAT#: PH307891
CXCL12 MS Standard C13 and N15-labeled recombinant protein (NP_954637)
View other "SDF1" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CXCL12 MS Standard C13 and N15-labeled recombinant protein (NP_954637) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC207891 |
Predicted MW | 9.9 kDa |
Protein Sequence |
>RC207891 representing NM_199168
Red=Cloning site Green=Tags(s) MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQV CIDPKLKWIQEYLEKALNK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_954637 |
RefSeq Size | 1937 |
RefSeq ORF | 267 |
Synonyms | IRH; PBSF; SCYB12; SDF1; TLSF; TPAR1 |
Locus ID | 6387 |
Cytogenetics | 10q11.21 |
Summary | This antimicrobial gene encodes a stromal cell-derived alpha chemokine member of the intercrine family. The encoded protein functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4, and plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Mutations in this gene are associated with resistance to human immunodeficiency virus type 1 infections. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein |
Protein Pathways | Axon guidance, Chemokine signaling pathway, Cytokine-cytokine receptor interaction, Leukocyte transendothelial migration |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424610 | CXCL12 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424610 | Transient overexpression lysate of chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
CNY 3,080.00 |
|
TP307891 | Purified recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 1, with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20 µg |
CNY 2,900.00 |
|
TP720102 | Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
CNY 5,460.00 |
|
TP720103 | Recombinant protein of human chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1) (CXCL12), transcript variant 2 |
CNY 5,460.00 |
|
TP723784 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12 / SDF-1alpha), transcript variant 1 |
CNY 4,970.00 |
|
TP723843 | Purified recombinant protein of Human chemokine (C-X-C motif) ligand 12 (CXCL12 / SDF-1beta), transcript variant 2 |
CNY 4,970.00 |
|
TP750013 | Recombinant protein of human stromal cell-derived factor-1 (SDF-1) produced in E. coli. |
CNY 4,020.00 |