WASF2 (NM_006990) Human Mass Spec Standard
CAT#: PH308034
WASF2 MS Standard C13 and N15-labeled recombinant protein (NP_008921)
View other "WASF2" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | WASF2 MS Standard C13 and N15-labeled recombinant protein (NP_008921) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208034 |
| Predicted MW | 54.1 kDa |
| Protein Sequence |
>RC208034 representing NM_006990
Red=Cloning site Green=Tags(s) MPLVTRNIEPRHLCRQTLPSVRSELECVTNITLANVIRQLGSLSKYAEDIFGELFTQANTFASRVSSLAE RVDRLQVKVTQLDPKEEEVSLQGINTRKAFRSSTIQDQKLFDRNSLPVPVLETYNTCDTPPPLNNLTPYR DDGKEALKFYTDPSYFFDLWKEKMLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQ EFVESKEKLGTSGYPPTLVYQNGSIGCVENVDASSYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPVDN QRGSGLAGPKRSSVVSPSHPPPAPPLGSPPGPKPGFAPPPAPPPPPPPMIGIPPPPPPVGFGSPGTPPPP SPPSFPPHPDFAAPPPPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPPGPPPPPFTGADGQPAIPPPL SDTTKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQEKRDVVGNDVATILSRRIAVEYSDSEDDSSE FDEDDWSD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_008921 |
| RefSeq Size | 4270 |
| RefSeq ORF | 1494 |
| Synonyms | dJ393P12.2; IMD2; SCAR2; WASF4; WAVE2 |
| Locus ID | 10163 |
| Cytogenetics | 1p36.11 |
| Summary | This gene encodes a member of the Wiskott-Aldrich syndrome protein family. The gene product is a protein that forms a multiprotein complex that links receptor kinases and actin. Binding to actin occurs through a C-terminal verprolin homology domain in all family members. The multiprotein complex serves to tranduce signals that involve changes in cell shape, motility or function. The published map location (PMID:10381382) has been changed based on recent genomic sequence comparisons, which indicate that the expressed gene is located on chromosome 1, and a pseudogene may be located on chromosome X. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2011] |
| Protein Families | Druggable Genome |
| Protein Pathways | Adherens junction, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416273 | WASF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416273 | Transient overexpression lysate of WAS protein family, member 2 (WASF2) |
CNY 3080.00 |
|
| TP308034 | Recombinant protein of human WAS protein family, member 2 (WASF2), 20 µg |
CNY 2900.00 |
