UBF1 (UBTF) (NM_001076683) Human Mass Spec Standard
CAT#: PH308047
UBTF MS Standard C13 and N15-labeled recombinant protein (NP_001070151)
View other "UBF1" proteins (7)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | UBTF MS Standard C13 and N15-labeled recombinant protein (NP_001070151) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208047 |
| Predicted MW | 84.8 kDa |
| Protein Sequence |
>RC208047 representing NM_001076683
Red=Cloning site Green=Tags(s) MNGEADCPTDLEMAAPKGQDRWSQEDMLTLLECMKNNLPSNDSSKFKTTESHMDWEKVAFKDFSGDMCKL KWVEISNEVRKFRTLTELILDAQEHVKNPYKGKKLKKHPDFPKKPLTPYFRFFMEKRAKYAKLHPEMSNL DLTKILSKKYKELPEKKKMKYIQDFQREKQEFERNLARFREDHPDLIQNAKKSDIPEKPKTPQQLWYTHE KKVYLKVRPDEIMRDYIQKHPELNISEEGITKSTLTKAERQLKDKFDGRPTKPPPNSYSLYCAELMANMK DVPSTERMVLCSQQWKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQA TSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKKAKYK AREAALKAQSERKPGGEREERGKLPESPKRAEEIWQQSVIGDYLARFKNDRVKALKAMEMTWNNMEKKEK LMWIKKAAEDQKRYERELSEMRAPPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERM VEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYISNKRKSMTKLRGPNPKSS RTTLQSKSESEEDDEEDEDDEDEDEEEEDDENGDSSEDGGDSSESSSEDESEDGDENEEDDEDEDDDEDD DEDEDNESEGSSSSSSSSGDSSDSDSN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001070151 |
| RefSeq Size | 4635 |
| RefSeq ORF | 2181 |
| Synonyms | CONDBA; NOR-90; UBF; UBF-1; UBF1; UBF2 |
| Locus ID | 7343 |
| Cytogenetics | 17q21.31 |
| Summary | This gene encodes a member of the HMG-box DNA-binding protein family. The encoded protein plays a critical role in ribosomal RNA transcription as a key component of the pre-initiation complex, mediating the recruitment of RNA polymerase I to rDNA promoter regions. The encoded protein may also play important roles in chromatin remodeling and pre-rRNA processing, and its activity is regulated by both phosphorylation and acetylation. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. Pseudogenes of this gene are located on the short arm of chromosomes 3, 11 and X and the long arm of chromosome 11. [provided by RefSeq, Aug 2011] |
| Protein Families | Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC421360 | UBTF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC421361 | UBTF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LC425832 | UBTF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1470.00 |
|
| LY421360 | Transient overexpression lysate of upstream binding transcription factor, RNA polymerase I (UBTF), transcript variant 2 |
CNY 3080.00 |
|
| LY421361 | Transient overexpression lysate of upstream binding transcription factor, RNA polymerase I (UBTF), transcript variant 3 |
CNY 4840.00 |
|
| LY425832 | Transient overexpression lysate of upstream binding transcription factor, RNA polymerase I (UBTF), transcript variant 2 |
CNY 4840.00 |
|
| TP308047 | Recombinant protein of human upstream binding transcription factor, RNA polymerase I (UBTF), transcript variant 2, 20 µg |
CNY 2900.00 |
