MRPL43 (NM_176792) Human Mass Spec Standard
CAT＃: PH308068
MRPL43 MS Standard C13 and N15-labeled recombinant protein (NP_789762)
View other "MRPL43" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Product images
Specifications
| Product Data | |
| Description | MRPL43 MS Standard C13 and N15-labeled recombinant protein (NP_789762) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208068 |
| Predicted MW | 23.4 kDa |
| Protein Sequence |
>RC208068 protein sequence
Red=Cloning site Green=Tags(s) MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPGVVIYVNSRPC CVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFHTDNPSIQGQWHPFTNKPTTF RGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDLPTVDPISSSLTSAPAPMLSAVSCLPIVPALT TVCSA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_789762 |
| RefSeq Size | 2151 |
| RefSeq ORF | 645 |
| Synonyms | bMRP36a; L43mt; MRP-L43 |
| Locus ID | 84545 |
| Cytogenetics | 10q24.31 |
| Summary | Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. This gene and the gene for a semaphorin class 4 protein (SEMA4G) overlap at map location 10q24.31 and are transcribed in opposite directions. Sequence analysis identified multiple transcript variants encoding at least four different protein isoforms. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406120 | MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC406122 | MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410343 | MRPL43 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406120 | Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3080.00 |
|
| LY406122 | Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3080.00 |
|
| LY410343 | Transient overexpression lysate of mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3080.00 |
|
| PH303936 | MRPL43 MS Standard C13 and N15-labeled recombinant protein (NP_115488) |
CNY 19520.00 |
|
| TP303936 | Recombinant protein of human mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2900.00 |
|
| TP308068 | Recombinant protein of human mitochondrial ribosomal protein L43 (MRPL43), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2900.00 |
