CD53 (NM_000560) Human Mass Spec Standard
CAT#: PH308095
CD53 MS Standard C13 and N15-labeled recombinant protein (NP_000551)
View other "CD53" proteins (3)
| Need it in bulk or customized? Get a free quote | 
CNY 14250.00
Specifications
| Product Data | |
| Description | CD53 MS Standard C13 and N15-labeled recombinant protein (NP_000551) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC208095 | 
| Predicted MW | 24.2 kDa | 
| Protein Sequence | >RC208095 representing NM_000560 Red=Cloning site Green=Tags(s) MGMSSLKLLKYVLFFFNLLFWICGCCILGFGIYLLIHNNFGVLFHNLPSLTLGNVFVIVGSIIMVVAFLG CMGSIKENKCLLMSFFILLLIILLAEVTLAILLFVYEQKLNEYVAKGLTDSIHRYHSDNSTKAAWDSIQS FLQCCGINGTSDWTSGPPASCPSDRKVEGCYAKARLWFHSNFLYIGIITICVCVIEVLGMSFALTLNCQI DKTSQTIGL myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_000551 | 
| RefSeq Size | 1567 | 
| RefSeq ORF | 657 | 
| Synonyms | MOX44; TSPAN25 | 
| Locus ID | 963 | 
| Cytogenetics | 1p13.3 | 
| Summary | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It contributes to the transduction of CD2-generated signals in T cells and natural killer cells and has been suggested to play a role in growth regulation. Familial deficiency of this gene has been linked to an immunodeficiency associated with recurrent infectious diseases caused by bacteria, fungi and viruses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016] | 
| Protein Families | Transmembrane | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC424639 | CD53 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY424639 | Transient overexpression lysate of CD53 molecule (CD53), transcript variant 2 | CNY 3080.00 | |
| TP308095 | Purified recombinant protein of Homo sapiens CD53 molecule (CD53), transcript variant 2, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | 

 
                        

 
        