AP5S1 (NM_018347) Human Mass Spec Standard
CAT#: PH308115
C20orf29 MS Standard C13 and N15-labeled recombinant protein (NP_060817)
View other "AP5S1" proteins (3)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
CNY 3080.00
Specifications
| Product Data | |
| Description | C20orf29 MS Standard C13 and N15-labeled recombinant protein (NP_060817) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208115 |
| Predicted MW | 22.5 kDa |
| Protein Sequence |
>RC208115 protein sequence
Red=Cloning site Green=Tags(s) MVHAFLIHTLRAPNTEDTGLCRVLYSCVFGAEKSPDDPRPHGAERDRLLRKEQILAVARQVESMCRLQQQ ASGRPPMDLQPQSSDEQVPLHEAPRGAFRLAAENPFQEPRTVVWLGVLSLGFALVLDAHENLLLAEGTLR LLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAWPR myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060817 |
| RefSeq Size | 1864 |
| RefSeq ORF | 600 |
| Synonyms | C20orf29 |
| Locus ID | 55317 |
| Cytogenetics | 20p13 |
| Summary | As part of AP-5, a probable fifth adaptor protein complex it may be involved in endosomal transport. According to PubMed:20613862, it is required for efficient homologous recombination DNA double-strand break repair.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413100 | AP5S1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413100 | Transient overexpression lysate of chromosome 20 open reading frame 29 (C20orf29) |
CNY 3080.00 |
|
| TP308115 | Recombinant protein of human chromosome 20 open reading frame 29 (C20orf29), 20 µg |
CNY 2900.00 |
