PDP1 (NM_018444) Human Mass Spec Standard
CAT#: PH308198
PDP1 MS Standard C13 and N15-labeled recombinant protein (NP_060914)
View other "PDP1" proteins (6)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | PDP1 MS Standard C13 and N15-labeled recombinant protein (NP_060914) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208198 |
| Predicted MW | 61.1 kDa |
| Protein Sequence |
>RC208198 protein sequence
Red=Cloning site Green=Tags(s) MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRR YASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLL GVFDGHAGCACSQAVSERLFYYIAVSLLPHETLLEIENAVESGRALLPILQWHKHPNDYFSKEASKLYFN SLRTYWQELIDLNTGESTDIDVKEALINAFKRLDNDISLEAQVGDPNSFLNYLVLRVAFSGATACVAHVD GVDLHVANTGDSRAMLGVQEEDGSWSAVTLSNDHNAQNERELERLKLEHPKSEAKSVVKQDRLLGLLMPF RAFGDVKFKWSIDLQKRVIESGPDQLNDNEYTKFIPPNYHTPPYLTAEPEVTYHRLRPQDKFLVLATDGL WETMHRQDVVRIVGEYLTGMHHQQPIAVGGYKVTLGQMHGLLTERRTKMSSVFEDQNAATHLIRHAVGNN EFGTVDHERLSKMLSLPEELARMYRDDITIIVVQFNSHVVGAYQNQE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_060914 |
| RefSeq Size | 4291 |
| RefSeq ORF | 1611 |
| Synonyms | PDH; PDP; PDPC; PPM2A; PPM2C |
| Locus ID | 54704 |
| Cytogenetics | 8q22.1 |
| Summary | Pyruvate dehydrogenase (E1) is one of the three components (E1, E2, and E3) of the large pyruvate dehydrogenase complex. Pyruvate dehydrogenase kinases catalyze phosphorylation of serine residues of E1 to inactivate the E1 component and inhibit the complex. Pyruvate dehydrogenase phosphatases catalyze the dephosphorylation and activation of the E1 component to reverse the effects of pyruvate dehydrogenase kinases. Pyruvate dehydrogenase phosphatase is a heterodimer consisting of catalytic and regulatory subunits. Two catalytic subunits have been reported; one is predominantly expressed in skeletal muscle and another one is is much more abundant in the liver. The catalytic subunit, encoded by this gene, is the former, and belongs to the protein phosphatase 2C (PP2C) superfamily. Along with the pyruvate dehydrogenase complex and pyruvate dehydrogenase kinases, this enzyme is located in the mitochondrial matrix. Mutation in this gene causes pyruvate dehydrogenase phosphatase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Jun 2009] |
| Protein Families | Druggable Genome, Phosphatase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC413026 | PDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431974 | PDP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY413026 | Transient overexpression lysate of pyruvate dehyrogenase phosphatase catalytic subunit 1 (PDP1), nuclear gene encoding mitochondrial protein, transcript variant 5 |
CNY 3080.00 |
|
| LY431974 | Transient overexpression lysate of pyruvate dehyrogenase phosphatase catalytic subunit 1 (PDP1), nuclear gene encoding mitochondrial protein, transcript variant 4 |
CNY 3080.00 |
|
| TP308198 | Recombinant protein of human protein phosphatase 2C, magnesium-dependent, catalytic subunit (PPM2C), nuclear gene encoding mitochondrial protein, 20 µg |
CNY 2900.00 |
|
| TP328947 | Recombinant protein of human pyruvate dehyrogenase phosphatase catalytic subunit 1 (PDP1), nuclear gene encoding mitochondrial protein, transcript variant 4, 20 µg |
CNY 2900.00 |
