Neuronal calcium binding protein (NECAB3) (NM_031231) Human Mass Spec Standard
CAT#: PH308242
NECAB3 MS Standard C13 and N15-labeled recombinant protein (NP_112508)
View other "Neuronal calcium binding protein" proteins (5)
|
Need it in bulk or customized? Get a free quote |
CNY 19520.00
Specifications
| Product Data | |
| Description | NECAB3 MS Standard C13 and N15-labeled recombinant protein (NP_112508) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC208242 |
| Predicted MW | 40.8 kDa |
| Protein Sequence |
>RC208242 protein sequence
Red=Cloning site Green=Tags(s) MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVL SLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQF VTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPG SSDTGRSSEAEMQWRLQVNRLQELIDQLECKAPRLEPLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHR ALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTV FFPASWWIMNNN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_112508 |
| RefSeq Size | 1961 |
| RefSeq ORF | 1086 |
| Synonyms | APBA2BP; dJ63M2.4; dJ63M2.5; EFCBP3; NIP1; STIP3; SYTIP2; XB51 |
| Locus ID | 63941 |
| Cytogenetics | 20q11.22 |
| Summary | The protein encoded by this gene interacts with the amino-terminal domain of the neuron-specific X11-like protein (X11L), inhibits the association of X11L with amyloid precursor protein through a non-competitive mechanism, and abolishes the suppression of beta-amyloid production by X11L. This protein, together with X11L, may play an important role in the regulatory system of amyloid precursor protein metabolism and beta-amyloid generation. The protein is phosphorylated by NIMA-related expressed kinase 2, and localizes to the Golgi apparatus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410597 | NECAB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC410598 | NECAB3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410597 | Transient overexpression lysate of N-terminal EF-hand calcium binding protein 3 (NECAB3), transcript variant 1 |
CNY 3080.00 |
|
| LY410598 | Transient overexpression lysate of N-terminal EF-hand calcium binding protein 3 (NECAB3), transcript variant 2 |
CNY 3080.00 |
|
| TP308242 | Recombinant protein of human N-terminal EF-hand calcium binding protein 3 (NECAB3), transcript variant 1, 20 µg |
CNY 2900.00 |
其它Neuronal calcium binding protein产品
