Calprotectin (S100A9) (NM_002965) Human Mass Spec Standard
CAT#: PH308250
S100A9 MS Standard C13 and N15-labeled recombinant protein (NP_002956)
View other "S100A9" proteins (4)
| Need it in bulk or customized? Get a free quote | 
CNY 19520.00
Product images
 
                    
                
                                                
                                                
                                                
                                                    CNY 1999.00 
                                                    
                                                    CNY 2700.00
                                                
                                            
Specifications
| Product Data | |
| Description | S100A9 MS Standard C13 and N15-labeled recombinant protein (NP_002956) | 
| Species | Human | 
| Expression Host | HEK293 | 
| Expression cDNA Clone or AA Sequence | RC208250 | 
| Predicted MW | 13.2 kDa | 
| Protein Sequence | >RC208250 protein sequence Red=Cloning site Green=Tags(s) MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNA DKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP myc-FLAG tag | 
| Tag | C-Myc/DDK | 
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Concentration | >0.05 µg/µL as determined by microplate BCA method | 
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine | 
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 | 
| Reference Data | |
| RefSeq | NP_002956 | 
| RefSeq Size | 586 | 
| RefSeq ORF | 342 | 
| Synonyms | 60B8AG; CAGB; CFAG; CGLB; L1AG; LIAG; MAC387; MIF; MRP14; NIF; P14 | 
| Locus ID | 6280 | 
| Cytogenetics | 1q21.3 | 
| Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014] | 
Documents
| FAQs | 
| SDS | 
Resources
| 蛋白相关资源 | 
Other Versions
| SKU | Description | Size | Price | 
|---|---|---|---|
| LC401037 | S100A9 HEK293T cell transient overexpression lysate (as WB positive control) | CNY 900.00 | |
| LY401037 | Transient overexpression lysate of S100 calcium binding protein A9 (S100A9) | CNY 3080.00 | |
| TP308250 | Purified recombinant protein of human S100 calcium binding protein A9 (S100A9), with C-terminal MYC/DDK tag, secretory expressed in HEK293 cells, 20 µg | 
                                                        
                                                        
                                                        
                                                            CNY 2900.00 | |
| TP710019 | Recombinant protein of human S100 calcium binding protein A9 (S100A9), full length with N-terminal polyhistidine tag, expressed in sf9 cells. | CNY 4020.00 | 




 
        